(data stored in ACNUC7421 zone)

EMBL: AP011115.PE272

AP011115.PE272       Location/Qualifiers
FT   CDS             complement(291617..292009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48519"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR42"
FT                   /protein_id="BAH48519.1"
FT                   /translation="MTTAHPRPDLAAYNDAARMTQSQLVTELRALLGAKLVAYLGKVKE
FT                   TRAVRQWADGTRTINNDTDVERLRIAYRAARLIAERDTSAVAQTWFQGLNPILDDQPPA
FT                   LLLREGDLNDVGPKVLAAARQFAAVG"
     MTTAHPRPDL AAYNDAARMT QSQLVTELRA LLGAKLVAYL GKVKETRAVR QWADGTRTIN        60
     NDTDVERLRI AYRAARLIAE RDTSAVAQTW FQGLNPILDD QPPALLLREG DLNDVGPKVL       120
     AAARQFAAVG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page