(data stored in ACNUC7421 zone)

EMBL: AP011115.PE274

AP011115.PE274       Location/Qualifiers
FT   CDS             293973..294377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48521"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR44"
FT                   /protein_id="BAH48521.1"
FT                   /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLEQADSQIPW
FT                   TGVFADFARPPRAAPKPETTGETGDGVWAIYTVDGDGVARVEQVYATELDALRAHKHNI
FT                   DPHRSVRFLPYGVTVSVLDQQEESTPRETE"
     MGDNRPFGFD PDDLDRVIRE AGEELQGVKD RIVRFLEQAD SQIPWTGVFA DFARPPRAAP        60
     KPETTGETGD GVWAIYTVDG DGVARVEQVY ATELDALRAH KHNIDPHRSV RFLPYGVTVS       120
     VLDQQEESTP RETE                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page