(data stored in ACNUC7421 zone)

EMBL: AP011115.PE275

AP011115.PE275       Location/Qualifiers
FT   CDS             294628..295134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48522"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR45"
FT                   /protein_id="BAH48522.1"
FT                   /translation="MSGTDPPPLVVVPPGSGHTGDLGPIGVEFKLWGRDTGGVLSVVEH
FT                   PFPVGALVPPHLHTREDEFSIVTQGAIGFRSGDREAVLESGGYITKPRGEMHAMWNAGT
FT                   VPARMIEIISPAGFEHCFLEMSELIAAGGPDVTQIAAVAERYGLQFGEPDWLPDVIARY
FT                   SLTPP"
     MSGTDPPPLV VVPPGSGHTG DLGPIGVEFK LWGRDTGGVL SVVEHPFPVG ALVPPHLHTR        60
     EDEFSIVTQG AIGFRSGDRE AVLESGGYIT KPRGEMHAMW NAGTVPARMI EIISPAGFEH       120
     CFLEMSELIA AGGPDVTQIA AVAERYGLQF GEPDWLPDVI ARYSLTPP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page