(data stored in ACNUC7421 zone)

EMBL: AP011115.PE277

AP011115.PE277       Location/Qualifiers
FT   CDS             complement(296134..297174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48524"
FT                   /db_xref="GOA:C1AR47"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR47"
FT                   /protein_id="BAH48524.1"
FT                   /translation="MDPSAAPAVKVTHGAPAVMDTAPVMLTKRTCFSAISMVILAVAGL
FT                   LVATPGNSAAAPPAWRYTMVAFSNTSDRDMDVYESGDGTGFQPVGLSAFRPPSGLVRDP
FT                   SIFRNADGLYYLTYTTGGGANIGFARSSDRINWTPLGNYPVPFCCALMPGTGDGTGSAS
FT                   PPGFSGSAGFRDGPSLSPFVTKAWAPEWFVDGDRVNVILSLSTGGGFVPYLMTALEPSL
FT                   RLWSPPVPLAGIGADHIDTTVVKVGATYHAFTKNETKKVVEHAVASSVTGPYSFVPAGN
FT                   WGSLVEGPALAQLPNGAWRIYLDAYTEGKYLYSDSTDGLRTWSPVQELPGLSGTARHFG
FT                   VMTEPA"
     MDPSAAPAVK VTHGAPAVMD TAPVMLTKRT CFSAISMVIL AVAGLLVATP GNSAAAPPAW        60
     RYTMVAFSNT SDRDMDVYES GDGTGFQPVG LSAFRPPSGL VRDPSIFRNA DGLYYLTYTT       120
     GGGANIGFAR SSDRINWTPL GNYPVPFCCA LMPGTGDGTG SASPPGFSGS AGFRDGPSLS       180
     PFVTKAWAPE WFVDGDRVNV ILSLSTGGGF VPYLMTALEP SLRLWSPPVP LAGIGADHID       240
     TTVVKVGATY HAFTKNETKK VVEHAVASSV TGPYSFVPAG NWGSLVEGPA LAQLPNGAWR       300
     IYLDAYTEGK YLYSDSTDGL RTWSPVQELP GLSGTARHFG VMTEPA                      346
//

If you have problems or comments...

PBIL Back to PBIL home page