(data stored in ACNUC7421 zone)

EMBL: AP011115.PE278

AP011115.PE278       Location/Qualifiers
FT   CDS             complement(297356..298519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02780"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48525"
FT                   /db_xref="GOA:C1AR48"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR48"
FT                   /protein_id="BAH48525.1"
FT                   /translation="MRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQLVL
FT                   GFLLCLPIAWRRKYPRAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVSLYTLVAY
FT                   VDRRTAAVYAVGLVVDSALSIWLLEQELLAAGLFSVLVFALSWITAEFLGARRAYDEEV
FT                   AARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALTSNPDIA
FT                   KQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGLPVELE
FT                   LTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEITDNGNSS
FT                   GQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
     MRRFSLWLRG KPTVADSMLA AILFTLEVFV FTASGDRSPW VQLVLGFLLC LPIAWRRKYP        60
     RAAAGAVLVM SITITFISYS IGDLDAEHPG LLALAVSLYT LVAYVDRRTA AVYAVGLVVD       120
     SALSIWLLEQ ELLAAGLFSV LVFALSWITA EFLGARRAYD EEVAARLVVA DYDRDRRAED       180
     AVAAERTRIA RELHDVVAHA VSVMIVQADG ASYALTSNPD IAKQALTNIA STGREALAEL       240
     RRTVSLLRTE PATDDMPQHG TAGLARVVDM MRSAGLPVEL ELTGELDDIS PAVSLGVHRL       300
     VQESLTNVLR HAGERPRAKV RVRRRETDVL VEITDNGNSS GQFSLGSGNG LLGMRERVAV       360
     LHGTLEAGRQ TDGSWRVTAE LPLELED                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page