(data stored in ACNUC7421 zone)

EMBL: AP011115.PE279

AP011115.PE279       Location/Qualifiers
FT   CDS             298566..299333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48526"
FT                   /db_xref="GOA:C1AR49"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR49"
FT                   /protein_id="BAH48526.1"
FT                   /translation="MNAGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQA
FT                   ALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVFIP
FT                   LIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTGTFL
FT                   IISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLSMAVCNVIGAVTG
FT                   SRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
     MNAGDWALLL TAATAAGWVD AVVGGGGLIL IPALFLVAPQ LTPQAALATN KLTAFTGTSA        60
     AVVTFARRIP MNWRLLVPAG LLAAVASALG AATVSRIDKD VFIPLIMAVL VGVAVFVTIR       120
     PQLGTTLAKD PPTRRKVVAV VLLSAGLLGF YDGLFGPGTG TFLIISFATF LGTEFVRSAA       180
     MAKVINLGSN LGALVFFAAT GHVLWALGLS MAVCNVIGAV TGSRMALSKG AGFVRITLLI       240
     VVIAMVIRLG WQQFG                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page