(data stored in ACNUC7421 zone)

EMBL: AP011115.PE28

AP011115.PE28        Location/Qualifiers
FT   CDS             complement(24162..24527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00280"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48275"
FT                   /db_xref="GOA:C1AS26"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS26"
FT                   /protein_id="BAH48275.1"
FT                   /translation="MVMLWIACAGSAGAIARFVIDGAIKHRKASEFPWATATINVTGSL
FT                   LLGFVTGLILFHGVPREIQLIVGVGFCGGYTTFSTASFETVRLIQRQKYAAGIANAVGT
FT                   LTVTVIAGGAGLALASV"
     MVMLWIACAG SAGAIARFVI DGAIKHRKAS EFPWATATIN VTGSLLLGFV TGLILFHGVP        60
     REIQLIVGVG FCGGYTTFST ASFETVRLIQ RQKYAAGIAN AVGTLTVTVI AGGAGLALAS       120
     V                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page