(data stored in ACNUC7421 zone)

EMBL: AP011115.PE283

AP011115.PE283       Location/Qualifiers
FT   CDS             302657..303004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48530"
FT                   /db_xref="GOA:C1AR53"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR53"
FT                   /protein_id="BAH48530.1"
FT                   /translation="MTAPSTQRSTTIQEITVSNDVLEAAPPAHSIPHRHPDGREVLATA
FT                   KGILIATRGYGDAEAFDELLDVSRHHHVSVLRAAKSLVELATRRQTCPSVTTPAPSYAL
FT                   EFTEWTTLLAR"
     MTAPSTQRST TIQEITVSND VLEAAPPAHS IPHRHPDGRE VLATAKGILI ATRGYGDAEA        60
     FDELLDVSRH HHVSVLRAAK SLVELATRRQ TCPSVTTPAP SYALEFTEWT TLLAR            115
//

If you have problems or comments...

PBIL Back to PBIL home page