(data stored in ACNUC7421 zone)

EMBL: AP011115.PE284

AP011115.PE284       Location/Qualifiers
FT   CDS             complement(302973..304160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02840"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48531"
FT                   /db_xref="GOA:C1AR54"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR54"
FT                   /protein_id="BAH48531.1"
FT                   /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVNG
FT                   TGKATGGWAPVQVVLQQFAQGKFLGLLTVMFGIGLVIQQRSAERRGQRWPGGYPWRAAL
FT                   LMLDGALHFLLFTEFDVLTGYALTGLIVAFILTAGIRAQRTWIVCAVAVHAAMLALLVA
FT                   ALYSAPAREPQPLSPNPYADGSFWDLIVFRADNVLLFRLEVLFILPLSIALFLVGARLY
FT                   GARVLDPDRGVLRRRLMVAGLAIALPLDLALGLFGGDAGLILGRYGTAPIVALGLLAAI
FT                   AHRYADGRAPGAPGRALSGVGRAALSCYVLQNILCSIVCYGWGFGLAARLDGTTVVPAT
FT                   IALFGAVSATLIVVSRLWLRRFDRGPLEWLTHRAYQRLTRADRDGVTAPAASSIP"
     MTSQLSSSHR YAALDVMRGA AILGTLATNI WIFTNVEGLV GYVNGTGKAT GGWAPVQVVL        60
     QQFAQGKFLG LLTVMFGIGL VIQQRSAERR GQRWPGGYPW RAALLMLDGA LHFLLFTEFD       120
     VLTGYALTGL IVAFILTAGI RAQRTWIVCA VAVHAAMLAL LVAALYSAPA REPQPLSPNP       180
     YADGSFWDLI VFRADNVLLF RLEVLFILPL SIALFLVGAR LYGARVLDPD RGVLRRRLMV       240
     AGLAIALPLD LALGLFGGDA GLILGRYGTA PIVALGLLAA IAHRYADGRA PGAPGRALSG       300
     VGRAALSCYV LQNILCSIVC YGWGFGLAAR LDGTTVVPAT IALFGAVSAT LIVVSRLWLR       360
     RFDRGPLEWL THRAYQRLTR ADRDGVTAPA ASSIP                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page