(data stored in ACNUC7421 zone)

EMBL: AP011115.PE286

AP011115.PE286       Location/Qualifiers
FT   CDS             complement(304882..305535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48533"
FT                   /db_xref="GOA:C1AR56"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR56"
FT                   /protein_id="BAH48533.1"
FT                   /translation="MPSETRHSEGRPYVVAHVAVALDGATTGFEPDVGRFYELAATWRE
FT                   DVTLVGADTIVAQEQALAAAPRPGPVGDGPLLAVVDSRGRVGDWVWDALRDAGHWSEVL
FT                   ALHAEATPPRGDGRSVHELVTGTERVDLAAALKILGRRAGVEVVRVDSGGALLGALLGA
FT                   GLLDEVSLLVHPCLPGVRNNRLWHGTAPAAIRFDLIASRAFDDGVVWLRYQPVR"
     MPSETRHSEG RPYVVAHVAV ALDGATTGFE PDVGRFYELA ATWREDVTLV GADTIVAQEQ        60
     ALAAAPRPGP VGDGPLLAVV DSRGRVGDWV WDALRDAGHW SEVLALHAEA TPPRGDGRSV       120
     HELVTGTERV DLAAALKILG RRAGVEVVRV DSGGALLGAL LGAGLLDEVS LLVHPCLPGV       180
     RNNRLWHGTA PAAIRFDLIA SRAFDDGVVW LRYQPVR                                217
//

If you have problems or comments...

PBIL Back to PBIL home page