(data stored in ACNUC7421 zone)

EMBL: AP011115.PE287

AP011115.PE287       Location/Qualifiers
FT   CDS             complement(305572..305796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48534"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR57"
FT                   /protein_id="BAH48534.1"
FT                   /translation="MSPEQAHLIDVDRAFFIGDAADRAALEADPMFTSLPIYRDGRVTF
FT                   FADSEDPPVGAALSQSTILSLPYAIDQVL"
     MSPEQAHLID VDRAFFIGDA ADRAALEADP MFTSLPIYRD GRVTFFADSE DPPVGAALSQ        60
     STILSLPYAI DQVL                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page