(data stored in ACNUC7421 zone)

EMBL: AP011115.PE288

AP011115.PE288       Location/Qualifiers
FT   CDS             complement(305803..306606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02880"
FT                   /product="putative iron-siderophore binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48535"
FT                   /db_xref="GOA:C1AR58"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR58"
FT                   /protein_id="BAH48535.1"
FT                   /translation="MPTEHDLSAVRGFIRIRRERSAAVTFVALLLGVWLLAACGSATGE
FT                   RDSGAAPGDTYTVEHVYGTTEVPRDYERVVSVGYTDDQTMLAVGVKPVGMVDQYPAGGS
FT                   PDRNISWPWVEDLWAGTVPEVVMTNGESLNFEKVAALQPDLIVGVYSDITEGDYQRLSA
FT                   IAPTVAWAPDVADPFVAPWQDTARQIAKALGKEDEAEAAITEITDGMAQAVADHPEFGG
FT                   RRAVAFSWYDASLAPFASTDVRGKLLTDLGYRPVAEIDQAAGDKF"
     MPTEHDLSAV RGFIRIRRER SAAVTFVALL LGVWLLAACG SATGERDSGA APGDTYTVEH        60
     VYGTTEVPRD YERVVSVGYT DDQTMLAVGV KPVGMVDQYP AGGSPDRNIS WPWVEDLWAG       120
     TVPEVVMTNG ESLNFEKVAA LQPDLIVGVY SDITEGDYQR LSAIAPTVAW APDVADPFVA       180
     PWQDTARQIA KALGKEDEAE AAITEITDGM AQAVADHPEF GGRRAVAFSW YDASLAPFAS       240
     TDVRGKLLTD LGYRPVAEID QAAGDKF                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page