(data stored in ACNUC7421 zone)

EMBL: AP011115.PE289

AP011115.PE289       Location/Qualifiers
FT   CDS             complement(306683..308050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48536"
FT                   /db_xref="GOA:C1AR59"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR59"
FT                   /protein_id="BAH48536.1"
FT                   /translation="MNVPRRDAHAVVIGGSIAGLLASRVLADYFDTVTIFEKDHLVDSA
FT                   EPRMGVPQGRHVHSIWKRGLSLMEESFPGLTSELIEGGSAEVEMTKDFAWYHRGVWKLR
FT                   VPSGIFITCQTRPFLEWQIRRRVCQISNIDLVDHCHVKRFVTDATAQRITGVAVQSRRA
FT                   GATEETVSADLVVDASGRGSRTPRWLEELGYGRPDMSVIDVDVGYATRFYARPPQEDCP
FT                   WKALIVAPTPPDGTRLGVIFPVEGQRWIVMLGGWNGDHPPRDEDGLLEFARNLEAPDIY
FT                   TFMREAEPLTPIAGYKFRANVRRHYERMRRFPGGLIVLGDSLCSFNPIYGQGMTTSALD
FT                   AMTLRECLDRAVHRGESLDAMAHHFLKRVPRRLDAPWRLAAGEDMNWPGTQGDAPFGTP
FT                   FMNWYFGRVHALAARDPQVLVRFVRVANMIDSPVRIFHPRVLAPVLTRSTRVAPSP"
     MNVPRRDAHA VVIGGSIAGL LASRVLADYF DTVTIFEKDH LVDSAEPRMG VPQGRHVHSI        60
     WKRGLSLMEE SFPGLTSELI EGGSAEVEMT KDFAWYHRGV WKLRVPSGIF ITCQTRPFLE       120
     WQIRRRVCQI SNIDLVDHCH VKRFVTDATA QRITGVAVQS RRAGATEETV SADLVVDASG       180
     RGSRTPRWLE ELGYGRPDMS VIDVDVGYAT RFYARPPQED CPWKALIVAP TPPDGTRLGV       240
     IFPVEGQRWI VMLGGWNGDH PPRDEDGLLE FARNLEAPDI YTFMREAEPL TPIAGYKFRA       300
     NVRRHYERMR RFPGGLIVLG DSLCSFNPIY GQGMTTSALD AMTLRECLDR AVHRGESLDA       360
     MAHHFLKRVP RRLDAPWRLA AGEDMNWPGT QGDAPFGTPF MNWYFGRVHA LAARDPQVLV       420
     RFVRVANMID SPVRIFHPRV LAPVLTRSTR VAPSP                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page