(data stored in ACNUC7421 zone)

EMBL: AP011115.PE29

AP011115.PE29        Location/Qualifiers
FT   CDS             complement(24521..25015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00290"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48276"
FT                   /db_xref="GOA:C1AS27"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS27"
FT                   /protein_id="BAH48276.1"
FT                   /translation="MDGRRDPNPTLPVDPDTAPRTPGPLHVRPAAIAAVGAGGLIGAPL
FT                   RYQFGVWFPQAAGGWPVTTFAINIVGAFLLGLLLEALTRLGPDDRWRQRVRLGVGTGVL
FT                   GSFTTYSTLAVDTDLLLRSHQWWEAGSYAAGTVLVGLVATTAGIAVGAQLRSRRTEAER
FT                   W"
     MDGRRDPNPT LPVDPDTAPR TPGPLHVRPA AIAAVGAGGL IGAPLRYQFG VWFPQAAGGW        60
     PVTTFAINIV GAFLLGLLLE ALTRLGPDDR WRQRVRLGVG TGVLGSFTTY STLAVDTDLL       120
     LRSHQWWEAG SYAAGTVLVG LVATTAGIAV GAQLRSRRTE AERW                        164
//

If you have problems or comments...

PBIL Back to PBIL home page