(data stored in ACNUC7421 zone)

EMBL: AP011115.PE290

AP011115.PE290       Location/Qualifiers
FT   CDS             complement(308247..308642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48537"
FT                   /db_xref="GOA:C1AR60"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR60"
FT                   /protein_id="BAH48537.1"
FT                   /translation="MGRVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLMW
FT                   TVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDVADTDHTRDVIARKYGIL
FT                   GWLTMKGSLLRRGKTGTIGLAVTADDR"
     MGRVTTEFDR VSSAKYVLLT TFRKDGTPVA TPLWAAADGD RLLMWTVTDS YKVKRIRRNP        60
     EVTVAACDAR GKPKGPEVPA RAVILDVADT DHTRDVIARK YGILGWLTMK GSLLRRGKTG       120
     TIGLAVTADD R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page