(data stored in ACNUC7421 zone)

EMBL: AP011115.PE295

AP011115.PE295       Location/Qualifiers
FT   CDS             complement(315768..316664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48542"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR65"
FT                   /protein_id="BAH48542.1"
FT                   /translation="MTSAEKRIRDVFADAGCTGWLHARRVGTPAGEVGVGADDLVVLAS
FT                   VYKLPLLVALCRAFESGELSPTATVRVNPADCTPGPTGVSTFRDPVVLSWRDLALSMMT
FT                   VSDNAAADLVLGQVGLESVERALSDLGLTNTRIIGGTADAHHRLVIDAHAHTTAEAFAA
FT                   LADNDEAWTVSAYDPSYASATTPREMTSLLDAIWAGRAVPGAQGGFVRQVMSAQIWQHR
FT                   IRSGFPHSGVDVAGKTGTIGAIRNEVAVVTFPGEIPVAVAVFTRAARTDPVLPVVDAAI
FT                   GHAARIAVTELRSGSVD"
     MTSAEKRIRD VFADAGCTGW LHARRVGTPA GEVGVGADDL VVLASVYKLP LLVALCRAFE        60
     SGELSPTATV RVNPADCTPG PTGVSTFRDP VVLSWRDLAL SMMTVSDNAA ADLVLGQVGL       120
     ESVERALSDL GLTNTRIIGG TADAHHRLVI DAHAHTTAEA FAALADNDEA WTVSAYDPSY       180
     ASATTPREMT SLLDAIWAGR AVPGAQGGFV RQVMSAQIWQ HRIRSGFPHS GVDVAGKTGT       240
     IGAIRNEVAV VTFPGEIPVA VAVFTRAART DPVLPVVDAA IGHAARIAVT ELRSGSVD         298
//

If you have problems or comments...

PBIL Back to PBIL home page