(data stored in ACNUC7421 zone)

EMBL: AP011115.PE3

AP011115.PE3         Location/Qualifiers
FT   CDS             complement(1496..1861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48250"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS01"
FT                   /protein_id="BAH48250.1"
FT                   /translation="MADGSHYTYRVTWSEPDSEFVGIVAEFPSLSWLAETQNEALDGIV
FT                   AVVRDVLEDMASTGEQPPVPIADRSYSGIFTVRTSPRVHRTLAVEAEEQGVSLNLLVNQ
FT                   KLSAPVGGRTGAETKAG"
     MADGSHYTYR VTWSEPDSEF VGIVAEFPSL SWLAETQNEA LDGIVAVVRD VLEDMASTGE        60
     QPPVPIADRS YSGIFTVRTS PRVHRTLAVE AEEQGVSLNL LVNQKLSAPV GGRTGAETKA       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page