(data stored in ACNUC7421 zone)

EMBL: AP011115.PE30

AP011115.PE30        Location/Qualifiers
FT   CDS             complement(25363..26238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48277"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS28"
FT                   /protein_id="BAH48277.1"
FT                   /translation="MTLHRHIPRFLCTPKRVALAGDWHANTDYAVEAIAHARRRNADVV
FT                   IHLGDFGFNFKPDYLNALDRALAQHHLVLGFVDGNHENFDWLLAQPVAADGLRYLRQRI
FT                   VHLPRGLRWRWGNTRCLAVGGAHSIDTFLRTPQVTWWPQEEITAEQARSITDGGQGVDA
FT                   MFCHDCPAGIAVPGMERDRYGFPAEAVAASEHHRQVLRGIVDGVQPIRLWHGHFHHRYQ
FT                   AVLDGDGYRAVIDGLGRDKDPIDNNMVVVNLAALGNHQAASRDGQIRPEHAILYPEEEG
FT                   EPPTLSAVPG"
     MTLHRHIPRF LCTPKRVALA GDWHANTDYA VEAIAHARRR NADVVIHLGD FGFNFKPDYL        60
     NALDRALAQH HLVLGFVDGN HENFDWLLAQ PVAADGLRYL RQRIVHLPRG LRWRWGNTRC       120
     LAVGGAHSID TFLRTPQVTW WPQEEITAEQ ARSITDGGQG VDAMFCHDCP AGIAVPGMER       180
     DRYGFPAEAV AASEHHRQVL RGIVDGVQPI RLWHGHFHHR YQAVLDGDGY RAVIDGLGRD       240
     KDPIDNNMVV VNLAALGNHQ AASRDGQIRP EHAILYPEEE GEPPTLSAVP G                291
//

If you have problems or comments...

PBIL Back to PBIL home page