(data stored in ACNUC7421 zone)

EMBL: AP011115.PE302

AP011115.PE302       Location/Qualifiers
FT   CDS             complement(321359..322498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03020"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48549"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR72"
FT                   /protein_id="BAH48549.1"
FT                   /translation="MAGKVVKRAFKYRFYPTEVRADQLARTFGCTRYVYNRALAERSRA
FT                   WSKEGRRVSYADNSTMLTRRKREAETAWLAEPSKGPLQESLRQLQGAFDKFWRIQARYP
FT                   QFKRKGRSKDSATYFSNCLTFRGGQIRLAKQSEPLDIRWSRPLPEGATPSQVTVSRNAR
FT                   GEYHISILVEDTIPELDRTDRVVGLDAGITSLYTLSTGEKIPNPRHERRDRERLAKAQR
FT                   VLARKQKGSRNRAKARLKVAKIHGRIADRRRDYLHTLSTRLVRENQVIAIEDLSVRNMV
FT                   KNRSLSRAISDAGWSEFRSMLEYKADWYGRVVAIDRFHPSSKTCSVCGEVVSAMPLKVR
FT                   EWTCRCGVVHDRDVNAARNILAVGLAVAACGDGVRPPRT"
     MAGKVVKRAF KYRFYPTEVR ADQLARTFGC TRYVYNRALA ERSRAWSKEG RRVSYADNST        60
     MLTRRKREAE TAWLAEPSKG PLQESLRQLQ GAFDKFWRIQ ARYPQFKRKG RSKDSATYFS       120
     NCLTFRGGQI RLAKQSEPLD IRWSRPLPEG ATPSQVTVSR NARGEYHISI LVEDTIPELD       180
     RTDRVVGLDA GITSLYTLST GEKIPNPRHE RRDRERLAKA QRVLARKQKG SRNRAKARLK       240
     VAKIHGRIAD RRRDYLHTLS TRLVRENQVI AIEDLSVRNM VKNRSLSRAI SDAGWSEFRS       300
     MLEYKADWYG RVVAIDRFHP SSKTCSVCGE VVSAMPLKVR EWTCRCGVVH DRDVNAARNI       360
     LAVGLAVAAC GDGVRPPRT                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page