(data stored in ACNUC7421 zone)

EMBL: AP011115.PE304

AP011115.PE304       Location/Qualifiers
FT   CDS             323261..325357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03040"
FT                   /product="putative drug resistance efflux protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48551"
FT                   /db_xref="GOA:C1AR74"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR74"
FT                   /protein_id="BAH48551.1"
FT                   /translation="MICAIGPSMEVLLVGRAVQGLGGGLLAGLNYAVLREALPEHLWAR
FT                   ATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVAAAIAVIAPRALPRTGRVRG
FT                   GRTRPGHVTRSAHPGDDRDQCGGDPRQPHPHADPDRSGSRLRRSVPGLGAAITAPGAAA
FT                   VDVPPGVVPEVDLPHHRGPRVRNRVRGLHTAVRSTARRIGAVRRGVPRRHDVGRLVGDH
FT                   DLQFRHLPTAGKDGGHAHRTARPRRRLAPHGGALARRRRTRRGDSVGRRAGRRRCGHRT
FT                   RLPAPDGRRHAEHRRRAGGRQGGGRAQHGRVDRDGCRVRGRRCAGQSRRTLDPRLRETA
FT                   LPRSRRHRNGRRVHRVSRDPGARRSALGPRREVVRATENVVGTGELRRMPAVRDAATVR
FT                   PQSLDRRLGPGDVVRVGCQRGVDHGYLLVRQGQLPGHPHLAGKPSVVPHALGAVRQRRP
FT                   VDRGRDPGRPAGIDEPGPGVCQRHRGSSGAGVAAIVADPEREPRDGSGASDVVHGHDGL
FT                   GRFDESNHRDTWDVGGRVPHLLGRFGFREHQPAQPGQAADRVEVALPVRGGCVVDPHPA
FT                   RIPFEPPRGATATVVLRGERQAVLEVDDQRIGAGGRRRGENLVPDRGDQKPASRHRDDD
FT                   LAALRCHDAHAVLSSAIPRSLRVTAGRRTRRSGVRRTCPGTASSGAAPPRAVRLRSRSP
FT                   RRPG"
     MICAIGPSME VLLVGRAVQG LGGGLLAGLN YAVLREALPE HLWARATALV SAMWGVGTLA        60
     GPAIGGLFAQ LGQWRLAFVA LAVVAAAIAV IAPRALPRTG RVRGGRTRPG HVTRSAHPGD       120
     DRDQCGGDPR QPHPHADPDR SGSRLRRSVP GLGAAITAPG AAAVDVPPGV VPEVDLPHHR       180
     GPRVRNRVRG LHTAVRSTAR RIGAVRRGVP RRHDVGRLVG DHDLQFRHLP TAGKDGGHAH       240
     RTARPRRRLA PHGGALARRR RTRRGDSVGR RAGRRRCGHR TRLPAPDGRR HAEHRRRAGG       300
     RQGGGRAQHG RVDRDGCRVR GRRCAGQSRR TLDPRLRETA LPRSRRHRNG RRVHRVSRDP       360
     GARRSALGPR REVVRATENV VGTGELRRMP AVRDAATVRP QSLDRRLGPG DVVRVGCQRG       420
     VDHGYLLVRQ GQLPGHPHLA GKPSVVPHAL GAVRQRRPVD RGRDPGRPAG IDEPGPGVCQ       480
     RHRGSSGAGV AAIVADPERE PRDGSGASDV VHGHDGLGRF DESNHRDTWD VGGRVPHLLG       540
     RFGFREHQPA QPGQAADRVE VALPVRGGCV VDPHPARIPF EPPRGATATV VLRGERQAVL       600
     EVDDQRIGAG GRRRGENLVP DRGDQKPASR HRDDDLAALR CHDAHAVLSS AIPRSLRVTA       660
     GRRTRRSGVR RTCPGTASSG AAPPRAVRLR SRSPRRPG                               698
//

If you have problems or comments...

PBIL Back to PBIL home page