(data stored in ACNUC7421 zone)

EMBL: AP011115.PE305

AP011115.PE305       Location/Qualifiers
FT   CDS             323562..324362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03050"
FT                   /product="putative drug resistance efflux protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48552"
FT                   /db_xref="GOA:C1AR75"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR75"
FT                   /protein_id="BAH48552.1"
FT                   /translation="MCAGGEPVPATSLALLTLATIAISVAGILGNRTHMLILIAVGVVF
FT                   VVLFLAWERRSPRRVLPRSTYRRGSSLKWIYLTIAVLASGTVSEAFTPLFGQRLAGLAP
FT                   FAAGFLGAMMSVGWSVTMIFSSDISRPRAKTAAMLTGPLVLAAGLLLTAALWRDDAGLA
FT                   VVILWAGVLAAAGAGIGLAFPHLMVAAMQSTDDAQEGAKAAAGLNTVELIAMAVGSAVA
FT                   GVLVNLGAPSTLASARLLFLGLGVIATVGVFTAYRATREPAGRR"
     MCAGGEPVPA TSLALLTLAT IAISVAGILG NRTHMLILIA VGVVFVVLFL AWERRSPRRV        60
     LPRSTYRRGS SLKWIYLTIA VLASGTVSEA FTPLFGQRLA GLAPFAAGFL GAMMSVGWSV       120
     TMIFSSDISR PRAKTAAMLT GPLVLAAGLL LTAALWRDDA GLAVVILWAG VLAAAGAGIG       180
     LAFPHLMVAA MQSTDDAQEG AKAAAGLNTV ELIAMAVGSA VAGVLVNLGA PSTLASARLL       240
     FLGLGVIATV GVFTAYRATR EPAGRR                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page