(data stored in ACNUC7421 zone)

EMBL: AP011115.PE309

AP011115.PE309       Location/Qualifiers
FT   CDS             326989..328005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03090"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48556"
FT                   /db_xref="GOA:C1AR79"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR79"
FT                   /protein_id="BAH48556.1"
FT                   /translation="MTPLSRLVSAAALGTVAVLALAACSEPAAADSEQAGAGTLTVYTS
FT                   EPQAKIDALVAAFTAETGIDVEVFRAGTGDLTARIEAERTTGTIGADVLLAADAPTFEG
FT                   YKTAGMLQQYTPADVNALNPDVVDPDGYYVGTRIIPTVIAYNTAAVDAPPTAWKDLADP
FT                   KYRGKITLPNPDVSGAAAFNTAVWLSTPELGEGWLEALAANDPVVAESNGPVGQAVAAG
FT                   TQPVGIVVDYLVRELAAKGSPIALTYPTDGIPYISQPAGIFTDSDDAEAARKFVDFLVS
FT                   KQGQELAVEQQYLPVRGDVGTPDGAPALSDLALLTPDLQEITKIQDDAVRKFNGLVG"
     MTPLSRLVSA AALGTVAVLA LAACSEPAAA DSEQAGAGTL TVYTSEPQAK IDALVAAFTA        60
     ETGIDVEVFR AGTGDLTARI EAERTTGTIG ADVLLAADAP TFEGYKTAGM LQQYTPADVN       120
     ALNPDVVDPD GYYVGTRIIP TVIAYNTAAV DAPPTAWKDL ADPKYRGKIT LPNPDVSGAA       180
     AFNTAVWLST PELGEGWLEA LAANDPVVAE SNGPVGQAVA AGTQPVGIVV DYLVRELAAK       240
     GSPIALTYPT DGIPYISQPA GIFTDSDDAE AARKFVDFLV SKQGQELAVE QQYLPVRGDV       300
     GTPDGAPALS DLALLTPDLQ EITKIQDDAV RKFNGLVG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page