(data stored in ACNUC7421 zone)

EMBL: AP011115.PE310

AP011115.PE310       Location/Qualifiers
FT   CDS             327989..329656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03100"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48557"
FT                   /db_xref="GOA:C1AR80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR80"
FT                   /protein_id="BAH48557.1"
FT                   /translation="MVSSVRTVSSNAARALPGQRFDPVGAVRVALWLFAAAVIVAPLAT
FT                   VVSLGFGGNHIAQLIDGGIAGAATHSAVSAGLSAVFAVALATVMALLLDRTDLPGRGIL
FT                   RLILLSPLLIPPFVGAIAWTGLLGPSGLVNRFWAERFGGPLWNIYGGDGVVFLLTVHSY
FT                   PLAYLIIAAALRKVPGDLEQIARIGGASPWRAMRTVTLPLLRPALLAAFTLTAVSNLAD
FT                   FGIPALIGLPERYVTLSTMVYRYIQSGTVDRPLEVVSTIGVVLLLLAVLAVFVDRRLSR
FT                   RSRQLDGPVTAPQPLPLGGGRIPVGTLAWTVGLALTGLPIFALASQALLPAPGVPLAWD
FT                   NLTLESIAAAVTAPGTVVGVQNSLLLAVGAGIVCAVAGLVLGVLTTRTRSRDNASLDLL
FT                   AMLPQAVPGLVIAVGWLIVGRYTGLFDTRWVILCAYVTAFLAIVVQAVRAPLSTTPASL
FT                   EEAARASGASRLRTLRDVPVAMTVPAAATGGVLVALTAVRELTMSVLLVAPGTQTLGVS
FT                   IFNLQQAGDYNAASALSLLVTIVGIAGLGLFAGTRAGR"
     MVSSVRTVSS NAARALPGQR FDPVGAVRVA LWLFAAAVIV APLATVVSLG FGGNHIAQLI        60
     DGGIAGAATH SAVSAGLSAV FAVALATVMA LLLDRTDLPG RGILRLILLS PLLIPPFVGA       120
     IAWTGLLGPS GLVNRFWAER FGGPLWNIYG GDGVVFLLTV HSYPLAYLII AAALRKVPGD       180
     LEQIARIGGA SPWRAMRTVT LPLLRPALLA AFTLTAVSNL ADFGIPALIG LPERYVTLST       240
     MVYRYIQSGT VDRPLEVVST IGVVLLLLAV LAVFVDRRLS RRSRQLDGPV TAPQPLPLGG       300
     GRIPVGTLAW TVGLALTGLP IFALASQALL PAPGVPLAWD NLTLESIAAA VTAPGTVVGV       360
     QNSLLLAVGA GIVCAVAGLV LGVLTTRTRS RDNASLDLLA MLPQAVPGLV IAVGWLIVGR       420
     YTGLFDTRWV ILCAYVTAFL AIVVQAVRAP LSTTPASLEE AARASGASRL RTLRDVPVAM       480
     TVPAAATGGV LVALTAVREL TMSVLLVAPG TQTLGVSIFN LQQAGDYNAA SALSLLVTIV       540
     GIAGLGLFAG TRAGR                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page