(data stored in ACNUC7421 zone)

EMBL: AP011115.PE311

AP011115.PE311       Location/Qualifiers
FT   CDS             329684..330787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03110"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48558"
FT                   /db_xref="GOA:C1AR81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR81"
FT                   /protein_id="BAH48558.1"
FT                   /translation="MSAITLTGVDLHYPDGTTGLSGVDLDVRDGEFVALVGPSGSGKTT
FT                   LLRTVAGFLAPTAGLVRLGDEVVADGTRAVPPDKRGLGMVFQQHAIWPHRSVGRNVAYP
FT                   LEVAKVPRARRAERVADVLDLVGLPGLAKRDPATLSGGQRQRVALARALVAQPRALLLD
FT                   EALSALDEPLRDRLRLELRTLTRAQNLTVVHVTHDRAEALALADRVVVLDSGRIQQVGT
FT                   PEELVQRPRSAFVAKFLSDASLLPGTVSEHGFSSTDGGVHVSRDRLADRSSGTGILAVL
FT                   PSDIEVTSTESAGTARGIVMSSLFGRDASDVVVSCRGAKFRCAVRGTRPAVGDRVGLTI
FT                   RRALFYPAPSKTAPPAHGAATLAGAPR"
     MSAITLTGVD LHYPDGTTGL SGVDLDVRDG EFVALVGPSG SGKTTLLRTV AGFLAPTAGL        60
     VRLGDEVVAD GTRAVPPDKR GLGMVFQQHA IWPHRSVGRN VAYPLEVAKV PRARRAERVA       120
     DVLDLVGLPG LAKRDPATLS GGQRQRVALA RALVAQPRAL LLDEALSALD EPLRDRLRLE       180
     LRTLTRAQNL TVVHVTHDRA EALALADRVV VLDSGRIQQV GTPEELVQRP RSAFVAKFLS       240
     DASLLPGTVS EHGFSSTDGG VHVSRDRLAD RSSGTGILAV LPSDIEVTST ESAGTARGIV       300
     MSSLFGRDAS DVVVSCRGAK FRCAVRGTRP AVGDRVGLTI RRALFYPAPS KTAPPAHGAA       360
     TLAGAPR                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page