(data stored in ACNUC7421 zone)

EMBL: AP011115.PE312

AP011115.PE312       Location/Qualifiers
FT   CDS             complement(330811..331437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03120"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48559"
FT                   /db_xref="GOA:C1AR82"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR82"
FT                   /protein_id="BAH48559.1"
FT                   /translation="MGGIGQQAAAVTSLAFVVAGLAVVAGRRRDAPTVTYGLLVVAVGV
FT                   GSLIQHGPDPPWQGYAHDIPIATVLAYIAVDAASDRFGRRMSPGWWLVVPLLMIPVVAA
FT                   GPTASTIVQALLAAVAVGLCLERARVRPELRRTTIVAAVLVASGALLGAVGDRTSICRP
FT                   DCLLPGHALWHVLAAAGLWRLAPTIGRPRARQRDGGTRSPGETGR"
     MGGIGQQAAA VTSLAFVVAG LAVVAGRRRD APTVTYGLLV VAVGVGSLIQ HGPDPPWQGY        60
     AHDIPIATVL AYIAVDAASD RFGRRMSPGW WLVVPLLMIP VVAAGPTAST IVQALLAAVA       120
     VGLCLERARV RPELRRTTIV AAVLVASGAL LGAVGDRTSI CRPDCLLPGH ALWHVLAAAG       180
     LWRLAPTIGR PRARQRDGGT RSPGETGR                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page