(data stored in ACNUC7421 zone)

EMBL: AP011115.PE313

AP011115.PE313       Location/Qualifiers
FT   CDS             331533..332267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48560"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR83"
FT                   /protein_id="BAH48560.1"
FT                   /translation="MGDTAVDAVAIYHATAANRRGTPWVALDYDVEPGSRHTLLQNLAG
FT                   RGWRNPSPAFDGVDDLPSAVLSLHSADGRTLLIEDGTDVLFEGVVVPPHGWLEHVRMLG
FT                   AVGVIAGAGITAAPDWQRQLPRLARESELLGSTATVTFSSAFGREDFHAFAYEVVSALR
FT                   PALPAEALHDAGFALEDDRPHRAVLEVLDSAVQHRVAVPARIVDMLERRAVDRTSFGWR
FT                   DARTLKRLLRKVHTDGRAPAGR"
     MGDTAVDAVA IYHATAANRR GTPWVALDYD VEPGSRHTLL QNLAGRGWRN PSPAFDGVDD        60
     LPSAVLSLHS ADGRTLLIED GTDVLFEGVV VPPHGWLEHV RMLGAVGVIA GAGITAAPDW       120
     QRQLPRLARE SELLGSTATV TFSSAFGRED FHAFAYEVVS ALRPALPAEA LHDAGFALED       180
     DRPHRAVLEV LDSAVQHRVA VPARIVDMLE RRAVDRTSFG WRDARTLKRL LRKVHTDGRA       240
     PAGR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page