(data stored in ACNUC7421 zone)

EMBL: AP011115.PE314

AP011115.PE314       Location/Qualifiers
FT   CDS             332390..333790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48561"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR84"
FT                   /protein_id="BAH48561.1"
FT                   /translation="MSRSVPGDGSDDPGHMAYARVRAGQVNAVQAALGDHTGRLEWPRE
FT                   QIEHYRTARLRALLSHARERSPFHARRLRGLDPSTATVADLASLPMMTKQDAQDEWDAI
FT                   VTTGDLDRARAERILAEQQWFSYTPNDEQIFSSGGSSGVRGVYVWDWQFYVSAACLAWR
FT                   VQAREERMVPMRPSSRLAVLAAGVPPHASTPLFDVPTAPGMETVVIPAGAPFDEILAAV
FT                   AAAHPTHLVGYASVIGRLARAALSGDLQVRPVRVSTNSEPLLDEDRQAIDEAWSVPIHN
FT                   LWGSTEIGVQAVGCGQGEGLHVCEDEVVLERVDAGGAPVAADAPAVRTLATGLANRTFP
FT                   FIRYDLGDQVTLLPGTCPCGSAFVRVADIGGRRDDDFRYGTKTVPASTFRYVLGADPRV
FT                   SEYQVRQTVDGAEIFAVGDPDVARLTSAVAAALRRQGLSDPQVRIEVVDHLQRHQASGK
FT                   LQRFIALR"
     MSRSVPGDGS DDPGHMAYAR VRAGQVNAVQ AALGDHTGRL EWPREQIEHY RTARLRALLS        60
     HARERSPFHA RRLRGLDPST ATVADLASLP MMTKQDAQDE WDAIVTTGDL DRARAERILA       120
     EQQWFSYTPN DEQIFSSGGS SGVRGVYVWD WQFYVSAACL AWRVQAREER MVPMRPSSRL       180
     AVLAAGVPPH ASTPLFDVPT APGMETVVIP AGAPFDEILA AVAAAHPTHL VGYASVIGRL       240
     ARAALSGDLQ VRPVRVSTNS EPLLDEDRQA IDEAWSVPIH NLWGSTEIGV QAVGCGQGEG       300
     LHVCEDEVVL ERVDAGGAPV AADAPAVRTL ATGLANRTFP FIRYDLGDQV TLLPGTCPCG       360
     SAFVRVADIG GRRDDDFRYG TKTVPASTFR YVLGADPRVS EYQVRQTVDG AEIFAVGDPD       420
     VARLTSAVAA ALRRQGLSDP QVRIEVVDHL QRHQASGKLQ RFIALR                      466
//

If you have problems or comments...

PBIL Back to PBIL home page