(data stored in ACNUC7421 zone)

EMBL: AP011115.PE316

AP011115.PE316       Location/Qualifiers
FT   CDS             complement(334379..334873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03160"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48563"
FT                   /db_xref="GOA:C1AR86"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR86"
FT                   /protein_id="BAH48563.1"
FT                   /translation="MTNKRISRLRGASVDYAIAAFRVVIGFLFFCHGTSTLFAWPTAPH
FT                   SGHTAAVGAWPSWWGAVIQLVCGAALFLGLGTRIAAFLASGSMAYAYFWSHQPDGALPI
FT                   QNNGELSAIFCWALFLMIFLGGGALSLDRLIAHGVRTARVDDEAAAGEPGSTDELREVN
FT                   A"
     MTNKRISRLR GASVDYAIAA FRVVIGFLFF CHGTSTLFAW PTAPHSGHTA AVGAWPSWWG        60
     AVIQLVCGAA LFLGLGTRIA AFLASGSMAY AYFWSHQPDG ALPIQNNGEL SAIFCWALFL       120
     MIFLGGGALS LDRLIAHGVR TARVDDEAAA GEPGSTDELR EVNA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page