(data stored in ACNUC7421 zone)

EMBL: AP011115.PE317

AP011115.PE317       Location/Qualifiers
FT   CDS             335041..335976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48564"
FT                   /db_xref="GOA:C1AR87"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR87"
FT                   /protein_id="BAH48564.1"
FT                   /translation="MLSMRDFRFSFNIFGFDSRDALLDRCRLGESAGYDTVFAADHLGA
FT                   PAPFPLLVAVAGATGLRVGTLVLNAPFWNAALLAREIATTDVLTDGRLEVGLGAGHMKW
FT                   EFDAAGVEWKAFGGRVEQLSELVDGLRTCFTTDFAELPEDRTVPRPLQRRGFGGSGPPL
FT                   IIGGTGDRVLRIAAAHADIVGVAGTFQIPGRPPGTFRLATADEAAERIRFVRTHAGARA
FT                   ERIEWHLLVQLVVETDDRRAAANEIAERLGGTMSVDDVLGTPYVLVGTVEEMAGQLRSH
FT                   RERYGFSYITVHEPYLEVFAPVIRRLREQN"
     MLSMRDFRFS FNIFGFDSRD ALLDRCRLGE SAGYDTVFAA DHLGAPAPFP LLVAVAGATG        60
     LRVGTLVLNA PFWNAALLAR EIATTDVLTD GRLEVGLGAG HMKWEFDAAG VEWKAFGGRV       120
     EQLSELVDGL RTCFTTDFAE LPEDRTVPRP LQRRGFGGSG PPLIIGGTGD RVLRIAAAHA       180
     DIVGVAGTFQ IPGRPPGTFR LATADEAAER IRFVRTHAGA RAERIEWHLL VQLVVETDDR       240
     RAAANEIAER LGGTMSVDDV LGTPYVLVGT VEEMAGQLRS HRERYGFSYI TVHEPYLEVF       300
     APVIRRLREQ N                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page