(data stored in ACNUC7421 zone)

EMBL: AP011115.PE32

AP011115.PE32        Location/Qualifiers
FT   CDS             complement(27480..27632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48279"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS30"
FT                   /protein_id="BAH48279.1"
FT                   /translation="MMLHPQGVSKFKIKILSIDEDGHALIESLLASPGTYPFSVQTKFL
FT                   VPADS"
     MMLHPQGVSK FKIKILSIDE DGHALIESLL ASPGTYPFSV QTKFLVPADS                   50
//

If you have problems or comments...

PBIL Back to PBIL home page