(data stored in ACNUC7421 zone)

EMBL: AP011115.PE320

AP011115.PE320       Location/Qualifiers
FT   CDS             complement(337287..338252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03200"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48567"
FT                   /db_xref="GOA:C1AR90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR90"
FT                   /protein_id="BAH48567.1"
FT                   /translation="MMTASITTRSAITTTGLRKSYGDKLVLDGIDLDIGEGTIFSLLGP
FT                   NGAGKTTMVQILSTLVAPDGGDVRIAGHDLTREPDAVRSTIGVTGQFSAVDNLLTGREN
FT                   LMLMADLHHLRRDAGRARATELLARFDLVEAGAKPAGSYSGGMRRRLDLAMTLVGDPRI
FT                   IFLDEPTTGLDPRSRRAMWQIIRELVADGVTIFLTTQYLEEADRLADRIALLDGGRLVA
FT                   EGTPEQLKRLVPGGHITLQLPGVRELDAASRLLGDAPRDEESLTLQVPGDGSVHSLRAL
FT                   LDRLDHASIEVENLTVHTPDLDDVFLALTERATTRKESVR"
     MMTASITTRS AITTTGLRKS YGDKLVLDGI DLDIGEGTIF SLLGPNGAGK TTMVQILSTL        60
     VAPDGGDVRI AGHDLTREPD AVRSTIGVTG QFSAVDNLLT GRENLMLMAD LHHLRRDAGR       120
     ARATELLARF DLVEAGAKPA GSYSGGMRRR LDLAMTLVGD PRIIFLDEPT TGLDPRSRRA       180
     MWQIIRELVA DGVTIFLTTQ YLEEADRLAD RIALLDGGRL VAEGTPEQLK RLVPGGHITL       240
     QLPGVRELDA ASRLLGDAPR DEESLTLQVP GDGSVHSLRA LLDRLDHASI EVENLTVHTP       300
     DLDDVFLALT ERATTRKESV R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page