(data stored in ACNUC7421 zone)

EMBL: AP011115.PE321

AP011115.PE321       Location/Qualifiers
FT   CDS             complement(338249..339127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48568"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR91"
FT                   /protein_id="BAH48568.1"
FT                   /translation="MPTFSTPAPISATVELVVGDARITATDRDDTVVDVHPSDGSRESD
FT                   VRAAEQTRVEYSAGRLLVKAPKQRGLGLFGKAGSVDVTIALPTGSEFEGEASVATFHGA
FT                   GRLGACRVKTSAGDVHLGDTGPLDVHTGAGAVTVDHVAGDADLSTGSGKLRAGAIDGSA
FT                   VIKNSNGDNWIGTIAGGLRVKTANGDISVDDARADLAAATANGDIRIGQVTRGAASVET
FT                   GHGRIEIGIRSGTAARLDAHTSFGKVHNHMDSVDRPESTDDKVDVRARTGFGDIVIRRV
FT                   DTQESTSRKAQ"
     MPTFSTPAPI SATVELVVGD ARITATDRDD TVVDVHPSDG SRESDVRAAE QTRVEYSAGR        60
     LLVKAPKQRG LGLFGKAGSV DVTIALPTGS EFEGEASVAT FHGAGRLGAC RVKTSAGDVH       120
     LGDTGPLDVH TGAGAVTVDH VAGDADLSTG SGKLRAGAID GSAVIKNSNG DNWIGTIAGG       180
     LRVKTANGDI SVDDARADLA AATANGDIRI GQVTRGAASV ETGHGRIEIG IRSGTAARLD       240
     AHTSFGKVHN HMDSVDRPES TDDKVDVRAR TGFGDIVIRR VDTQESTSRK AQ               292
//

If you have problems or comments...

PBIL Back to PBIL home page