(data stored in ACNUC7421 zone)

EMBL: AP011115.PE327

AP011115.PE327       Location/Qualifiers
FT   CDS             343947..344276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48574"
FT                   /db_xref="GOA:C1AR97"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR97"
FT                   /protein_id="BAH48574.1"
FT                   /translation="MDALRDRGEMEAQNLRQKFKEWLAALVHEVVHSNAGVGAGLEGIR
FT                   AALTGKNPVWAAIKALVSGLSGKAKFGLILLLVVALLLGPVLLVILLLVLLVAVIVAAV
FT                   RAATQ"
     MDALRDRGEM EAQNLRQKFK EWLAALVHEV VHSNAGVGAG LEGIRAALTG KNPVWAAIKA        60
     LVSGLSGKAK FGLILLLVVA LLLGPVLLVI LLLVLLVAVI VAAVRAATQ                   109
//

If you have problems or comments...

PBIL Back to PBIL home page