(data stored in ACNUC7421 zone)

EMBL: AP011115.PE328

AP011115.PE328       Location/Qualifiers
FT   CDS             344567..345274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48575"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR98"
FT                   /protein_id="BAH48575.1"
FT                   /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRDL
FT                   LERGTKVLANSPEFAKISDSVREELVSAAKAAAVTAASQRINKLNNRLLSGGGEAVSDV
FT                   GDTVDDTVGGVGNSVGKLSSLGKLGRKRRGRSKDEEYDESEVDEEPDEQYAEEDEDYEE
FT                   PEEEEPSDDEDEPPRRKRPAARRRASSNGSSRPTSRSRSAKSDEDDEEAPARGRRTRAK
FT                   ATTDSAPVRRGGR"
     MKTKGQVALA VGAGYMLGRT HRMKMALMLA AAGATGRFPG GPRDLLERGT KVLANSPEFA        60
     KISDSVREEL VSAAKAAAVT AASQRINKLN NRLLSGGGEA VSDVGDTVDD TVGGVGNSVG       120
     KLSSLGKLGR KRRGRSKDEE YDESEVDEEP DEQYAEEDED YEEPEEEEPS DDEDEPPRRK       180
     RPAARRRASS NGSSRPTSRS RSAKSDEDDE EAPARGRRTR AKATTDSAPV RRGGR            235
//

If you have problems or comments...

PBIL Back to PBIL home page