(data stored in ACNUC7421 zone)

EMBL: AP011115.PE329

AP011115.PE329       Location/Qualifiers
FT   CDS             345271..346437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48576"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR99"
FT                   /protein_id="BAH48576.1"
FT                   /translation="MSTMTNAAKKLREAAPGDGNGSSGVLQDALQKLVGTVTEKALSSV
FT                   TDKVQNASGRLTDYAEGGGGGLLAAVTGSEKLAEGESPIKSAVSGGWESAKQMAKDTAS
FT                   DVKEAVTGGGGSKGKKLKLTNIVETLDVGVPVQLAYNQWTQFADFPSFMKKVERVEQES
FT                   DEKLEWKAQVFLSHRTWEASIIEQVPDERIVWHSKGAKGYVDGAVTFHEVTPDLTRIVL
FT                   ILEYHPKGLFEKTGNIWRAPGRRARLELKHFGRHVMTQSVLHPDEVVGWRGEIRDGEVV
FT                   EPDEDETQQDEDETQPDESGELEETDDNEDEESEEEEEEPEQEESEETDEDESEDTDED
FT                   EETPPPARRGRPRKTAASSEERAAPKRRGRPRKTAAKKAAGSRQGARQ"
     MSTMTNAAKK LREAAPGDGN GSSGVLQDAL QKLVGTVTEK ALSSVTDKVQ NASGRLTDYA        60
     EGGGGGLLAA VTGSEKLAEG ESPIKSAVSG GWESAKQMAK DTASDVKEAV TGGGGSKGKK       120
     LKLTNIVETL DVGVPVQLAY NQWTQFADFP SFMKKVERVE QESDEKLEWK AQVFLSHRTW       180
     EASIIEQVPD ERIVWHSKGA KGYVDGAVTF HEVTPDLTRI VLILEYHPKG LFEKTGNIWR       240
     APGRRARLEL KHFGRHVMTQ SVLHPDEVVG WRGEIRDGEV VEPDEDETQQ DEDETQPDES       300
     GELEETDDNE DEESEEEEEE PEQEESEETD EDESEDTDED EETPPPARRG RPRKTAASSE       360
     ERAAPKRRGR PRKTAAKKAA GSRQGARQ                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page