(data stored in ACNUC7421 zone)

EMBL: AP011115.PE33

AP011115.PE33        Location/Qualifiers
FT   CDS             complement(27845..28666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00330"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48280"
FT                   /db_xref="GOA:C1AS31"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS31"
FT                   /protein_id="BAH48280.1"
FT                   /translation="MISAHDAHTTGTLGSGTVVALLLIAAVAAGYLVLAVRRRREARGW
FT                   SIWRSASFLTGIALLALAVTPTLSPYPVGDFRGHMHQHLLLGMYAPLGLVLGAPITLLL
FT                   RSIPPRHGRPIGRVLRSRPAHLLAHPVVALTLSVGGLAALYFTPLYTATTTDEALHLLV
FT                   HTHFLLAGYLFAWVIAGPDPAPHRPSVPVRLVVLGVAIAGHAVISQLMYAGLFVQIPVP
FT                   PDQRQGAGELMYYGGDVAELLLAVALLLTWRPDRHRPARPTDQISAPTAAT"
     MISAHDAHTT GTLGSGTVVA LLLIAAVAAG YLVLAVRRRR EARGWSIWRS ASFLTGIALL        60
     ALAVTPTLSP YPVGDFRGHM HQHLLLGMYA PLGLVLGAPI TLLLRSIPPR HGRPIGRVLR       120
     SRPAHLLAHP VVALTLSVGG LAALYFTPLY TATTTDEALH LLVHTHFLLA GYLFAWVIAG       180
     PDPAPHRPSV PVRLVVLGVA IAGHAVISQL MYAGLFVQIP VPPDQRQGAG ELMYYGGDVA       240
     ELLLAVALLL TWRPDRHRPA RPTDQISAPT AAT                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page