(data stored in ACNUC7421 zone)

EMBL: AP011115.PE332

AP011115.PE332       Location/Qualifiers
FT   CDS             347636..347887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48579"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA2"
FT                   /protein_id="BAH48579.1"
FT                   /translation="MGLMSFIVTLPLAPVRGVISLAELIQRQVEEELHNPASARRALEE
FT                   LEDARASGEISAEEEEQAQQAILDRMTGTARPNSPEKE"
     MGLMSFIVTL PLAPVRGVIS LAELIQRQVE EELHNPASAR RALEELEDAR ASGEISAEEE        60
     EQAQQAILDR MTGTARPNSP EKE                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page