(data stored in ACNUC7421 zone)

EMBL: AP011115.PE34

AP011115.PE34        Location/Qualifiers
FT   CDS             complement(28663..29208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00340"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48281"
FT                   /db_xref="GOA:C1AS32"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS32"
FT                   /protein_id="BAH48281.1"
FT                   /translation="MVAPQRETTAIPARGIGLPGIILGIGLGGFVDGILLHQLLQWHHM
FT                   LTSTDTDNVGIDTYPADTVHGLEINTVWDGLFHTFTWLAVLIGLGLLYSRVTHSHGRIW
FT                   ASRVLWGWVLVGWGLFNLVEGVIDHHLLGIHHVRGGDHQLWWDLGFLALGAVLVAGGWL
FT                   LQHSAAPAQPSADTTAPR"
     MVAPQRETTA IPARGIGLPG IILGIGLGGF VDGILLHQLL QWHHMLTSTD TDNVGIDTYP        60
     ADTVHGLEIN TVWDGLFHTF TWLAVLIGLG LLYSRVTHSH GRIWASRVLW GWVLVGWGLF       120
     NLVEGVIDHH LLGIHHVRGG DHQLWWDLGF LALGAVLVAG GWLLQHSAAP AQPSADTTAP       180
     R                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page