(data stored in ACNUC7421 zone)

EMBL: AP011115.PE341

AP011115.PE341       Location/Qualifiers
FT   CDS             352224..352529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48588"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB1"
FT                   /protein_id="BAH48588.1"
FT                   /translation="MRSAIAAAAALAAFSAPGIAAAAPNLHGDPNTPGTQVQVESEPGD
FT                   SNSYTCGAVGVAGAGVGSNSSGGAGSVNGAYFGPGPVQGGCVGSDGSVYFPTGNAE"
     MRSAIAAAAA LAAFSAPGIA AAAPNLHGDP NTPGTQVQVE SEPGDSNSYT CGAVGVAGAG        60
     VGSNSSGGAG SVNGAYFGPG PVQGGCVGSD GSVYFPTGNA E                           101
//

If you have problems or comments...

PBIL Back to PBIL home page