(data stored in ACNUC7421 zone)

EMBL: AP011115.PE342

AP011115.PE342       Location/Qualifiers
FT   CDS             complement(352820..353278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48589"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB2"
FT                   /protein_id="BAH48589.1"
FT                   /translation="MTTSDRQPEGTSPAGNVETPAEAPASAVEGTESPAGTTESAPGAA
FT                   TPPAAEAPPSAQDADTSVGQTLFAEDELSVLRLRWDEVQSGFVDDPRECVQKADGLVSD
FT                   VVDRITTGFSEARSRLEEQWARGEEGSTEDLRLALKRYREFFQRLLEL"
     MTTSDRQPEG TSPAGNVETP AEAPASAVEG TESPAGTTES APGAATPPAA EAPPSAQDAD        60
     TSVGQTLFAE DELSVLRLRW DEVQSGFVDD PRECVQKADG LVSDVVDRIT TGFSEARSRL       120
     EEQWARGEEG STEDLRLALK RYREFFQRLL EL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page