(data stored in ACNUC7421 zone)

EMBL: AP011115.PE343

AP011115.PE343       Location/Qualifiers
FT   CDS             complement(353275..353862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48590"
FT                   /db_xref="GOA:C1ARB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB3"
FT                   /protein_id="BAH48590.1"
FT                   /translation="MPVWGWILIAVLVVIAVLAIIASRSISSRKRTERLKGRFGPEYER
FT                   TVGEVGDQGAAEKELAARERKREKLDIVPLPPEARAKYADSWRTVQIEFVDNPSSAVAA
FT                   ADRLVIHVMRERGYPIDDFDQRAADISVDHPKVVENYRTAHGIYLAQEQGDIGTEDQRE
FT                   AFVHYRELFEKLLETDENNDEPNKDEPKETRA"
     MPVWGWILIA VLVVIAVLAI IASRSISSRK RTERLKGRFG PEYERTVGEV GDQGAAEKEL        60
     AARERKREKL DIVPLPPEAR AKYADSWRTV QIEFVDNPSS AVAAADRLVI HVMRERGYPI       120
     DDFDQRAADI SVDHPKVVEN YRTAHGIYLA QEQGDIGTED QREAFVHYRE LFEKLLETDE       180
     NNDEPNKDEP KETRA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page