(data stored in ACNUC7421 zone)

EMBL: AP011115.PE346

AP011115.PE346       Location/Qualifiers
FT   CDS             356425..356874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48593"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB6"
FT                   /protein_id="BAH48593.1"
FT                   /translation="MAQLAASAEPEVRAQLDAKIAVLDEHRTAVGLKRGKINRELAFHF
FT                   ARQTADYAAAAGATVIAVLDLTTLEARGHGRVNNNRAAQSARRKAVTALAHTAAGVGIA
FT                   VVSVGPADPPRGVRVATHPSHAPAAITPRGVQVAGSAATATTSPE"
     MAQLAASAEP EVRAQLDAKI AVLDEHRTAV GLKRGKINRE LAFHFARQTA DYAAAAGATV        60
     IAVLDLTTLE ARGHGRVNNN RAAQSARRKA VTALAHTAAG VGIAVVSVGP ADPPRGVRVA       120
     THPSHAPAAI TPRGVQVAGS AATATTSPE                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page