(data stored in ACNUC7421 zone)

EMBL: AP011115.PE35

AP011115.PE35        Location/Qualifiers
FT   CDS             complement(29291..30643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48282"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS33"
FT                   /protein_id="BAH48282.1"
FT                   /translation="MDVSIIETSSLGDRSYLISDGAVGVVVDPQRDIDRVLALARDRGV
FT                   RITHVLETHIHNDYVTGGLELSRTTGAEYVVPTGDDVGYQRRAVSDGDLIDAGPILLQV
FT                   LHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGKEHTEELTHAQYHSVR
FT                   RLADELPPDTEVYPTHGFGSFCAATPATGDSSTVGEQSKTNPALTRDEQSYVDELLAGL
FT                   ADYPAYYAHMGVLNTEGPPPVDLSLPKPVDPDELRRRIEDGEWVVDLRERTAFAAGHLG
FT                   GTLGFELSDSFVTYLGWLYTWGAPLTLIGDNEDQVADARRELVRIGIDDLDGAAVGEIH
FT                   TLVAGTALRSYRVADFAALSEALREKDITVLDVRQRNEYDDSHIDGAINIPLHELADRQ
FT                   STLPNREIWVHCASGYRASVAASMIDRPDRTTVLINDEFDNANDTDLTSTT"
     MDVSIIETSS LGDRSYLISD GAVGVVVDPQ RDIDRVLALA RDRGVRITHV LETHIHNDYV        60
     TGGLELSRTT GAEYVVPTGD DVGYQRRAVS DGDLIDAGPI LLQVLHTPGH THHHVSYVLR       120
     ETTGGIRGVF TGGSMLFGTT GRTDLLGKEH TEELTHAQYH SVRRLADELP PDTEVYPTHG       180
     FGSFCAATPA TGDSSTVGEQ SKTNPALTRD EQSYVDELLA GLADYPAYYA HMGVLNTEGP       240
     PPVDLSLPKP VDPDELRRRI EDGEWVVDLR ERTAFAAGHL GGTLGFELSD SFVTYLGWLY       300
     TWGAPLTLIG DNEDQVADAR RELVRIGIDD LDGAAVGEIH TLVAGTALRS YRVADFAALS       360
     EALREKDITV LDVRQRNEYD DSHIDGAINI PLHELADRQS TLPNREIWVH CASGYRASVA       420
     ASMIDRPDRT TVLINDEFDN ANDTDLTSTT                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page