(data stored in ACNUC7421 zone)

EMBL: AP011115.PE351

AP011115.PE351       Location/Qualifiers
FT   CDS             359666..360085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48598"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC1"
FT                   /protein_id="BAH48598.1"
FT                   /translation="MPESPPDRVQITDRLHVVANLLDTRDWPGFAATLTEDVVAYGRTG
FT                   PAAVVARVRSHLDVCGTTQHLLGNIRIDLDGDTARTTSYFRAFHLGLGDRAGASYECLG
FT                   EYRDQWRRGPSGWLLSGRVIDVRAEIGDRSVIAPR"
     MPESPPDRVQ ITDRLHVVAN LLDTRDWPGF AATLTEDVVA YGRTGPAAVV ARVRSHLDVC        60
     GTTQHLLGNI RIDLDGDTAR TTSYFRAFHL GLGDRAGASY ECLGEYRDQW RRGPSGWLLS       120
     GRVIDVRAEI GDRSVIAPR                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page