(data stored in ACNUC7421 zone)

EMBL: AP011115.PE352

AP011115.PE352       Location/Qualifiers
FT   CDS             complement(360099..361187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03520"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48599"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC2"
FT                   /protein_id="BAH48599.1"
FT                   /translation="MNARMRAFGVAVTVAATVLGACAAPPPGDDAAKKVYFFLPNTTTT
FT                   RFVERDEPLFTDFLELFAPKATVTVRNAEGDPARQQSQVESAIADGAAVLVLISADARF
FT                   SGGALTAAADANVPVVLYDHDAVGGPAEVQVIFDPLEVGRRQGSRAADLIAAMPGDGLK
FT                   IARVEGNLGEYGTRQFQLGQNEYLQPLIGSRKIRVVCETAIDDWDPAEGQAFAEECLTR
FT                   ENNDVDLFVTMNDDLAGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQGTLDNTIFK
FT                   NLSDQAKVAAQLTTSILHGADLPENMINGTIDNQYMAVPTVFLPVQNITQDNLHVVVNS
FT                   GFYTWQQICAPDPDSAVCREHD"
     MNARMRAFGV AVTVAATVLG ACAAPPPGDD AAKKVYFFLP NTTTTRFVER DEPLFTDFLE        60
     LFAPKATVTV RNAEGDPARQ QSQVESAIAD GAAVLVLISA DARFSGGALT AAADANVPVV       120
     LYDHDAVGGP AEVQVIFDPL EVGRRQGSRA ADLIAAMPGD GLKIARVEGN LGEYGTRQFQ       180
     LGQNEYLQPL IGSRKIRVVC ETAIDDWDPA EGQAFAEECL TRENNDVDLF VTMNDDLAGG       240
     IVAALAGRGL AGRIPVTGGQ DANLAALQLI AQGTLDNTIF KNLSDQAKVA AQLTTSILHG       300
     ADLPENMING TIDNQYMAVP TVFLPVQNIT QDNLHVVVNS GFYTWQQICA PDPDSAVCRE       360
     HD                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page