(data stored in ACNUC7421 zone)

EMBL: AP011115.PE354

AP011115.PE354       Location/Qualifiers
FT   CDS             362704..363693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03540"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48601"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC4"
FT                   /protein_id="BAH48601.1"
FT                   /translation="MVRPFRARRPGITRLLGGLAFGTVLIAGCGSPDAPTPMFSGDFTE
FT                   FPASVGARIIEPSESPPPDGQPSSCAPTVSLRPGIAGAGGALGEIRARGSLVVAVDQNT
FT                   NLFSFRDPTTGTLTGFGVDLAREVARDLLGDPAKVEFRPLGSGDGAEMLAHRDADMIVR
FT                   PVALPCESPQDVAFSTVYLETPRRLVVRVGSGISEPADLARRRVCTHDDPASVSALSRI
FT                   APKATIVAVPDWDDCLMAIQQRQVDAVVGAALLAGLVAQDPNLDIVGPDSDSARYAIAL
FT                   APGRDDLVRFVNGTLERLRTDGTWTALYDRWLSPLGPAPAPPSPDYRD"
     MVRPFRARRP GITRLLGGLA FGTVLIAGCG SPDAPTPMFS GDFTEFPASV GARIIEPSES        60
     PPPDGQPSSC APTVSLRPGI AGAGGALGEI RARGSLVVAV DQNTNLFSFR DPTTGTLTGF       120
     GVDLAREVAR DLLGDPAKVE FRPLGSGDGA EMLAHRDADM IVRPVALPCE SPQDVAFSTV       180
     YLETPRRLVV RVGSGISEPA DLARRRVCTH DDPASVSALS RIAPKATIVA VPDWDDCLMA       240
     IQQRQVDAVV GAALLAGLVA QDPNLDIVGP DSDSARYAIA LAPGRDDLVR FVNGTLERLR       300
     TDGTWTALYD RWLSPLGPAP APPSPDYRD                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page