(data stored in ACNUC7421 zone)

EMBL: AP011115.PE357

AP011115.PE357       Location/Qualifiers
FT   CDS             complement(365051..365494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03570"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48604"
FT                   /db_xref="GOA:C1ARC7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC7"
FT                   /protein_id="BAH48604.1"
FT                   /translation="MTSTPPATGAFDATPAPTDGTTKKARVAGLVVSALAVLFLLFDSL
FT                   IHIANTQMVREAMAELGFAENLNRVIGVVLLVCLILYIVPATSILGAVLLTGYLGGAVA
FT                   TNLLTEQPIVSTTLFPIYVGVFVWGGLYLRDPMVRSIMPVRRT"
     MTSTPPATGA FDATPAPTDG TTKKARVAGL VVSALAVLFL LFDSLIHIAN TQMVREAMAE        60
     LGFAENLNRV IGVVLLVCLI LYIVPATSIL GAVLLTGYLG GAVATNLLTE QPIVSTTLFP       120
     IYVGVFVWGG LYLRDPMVRS IMPVRRT                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page