(data stored in ACNUC7421 zone)

EMBL: AP011115.PE358

AP011115.PE358       Location/Qualifiers
FT   CDS             365700..366161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48605"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC8"
FT                   /protein_id="BAH48605.1"
FT                   /translation="MDGLVKLVIEATDLPGSSCPPGANFPGYDNIHVAVQRRGTPGDLL
FT                   DLHPGDATTARWVLECGTTPTPTGLDITGPYIQGRPGARFVYLSWGTVDGDGGFDMFRR
FT                   AKLMWDAVDPATANAAASAGRITARLGLTDARGNPLCAAVRPPLVEWSA"
     MDGLVKLVIE ATDLPGSSCP PGANFPGYDN IHVAVQRRGT PGDLLDLHPG DATTARWVLE        60
     CGTTPTPTGL DITGPYIQGR PGARFVYLSW GTVDGDGGFD MFRRAKLMWD AVDPATANAA       120
     ASAGRITARL GLTDARGNPL CAAVRPPLVE WSA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page