(data stored in ACNUC7421 zone)

EMBL: AP011115.PE359

AP011115.PE359       Location/Qualifiers
FT   CDS             complement(366234..367667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03590"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48606"
FT                   /db_xref="GOA:C1ARC9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC9"
FT                   /protein_id="BAH48606.1"
FT                   /translation="MTGRTANARRMSLRTLLWLAIGILVALFAVSAAFSVYGRLVVRAS
FT                   EDVLSERLLPAQRAVSDLTTAYVDQETGQRGYVLTGDPRFLEPYDAGRSAAAASLSDLT
FT                   ALLGGDAEASATLDAVVEAANTWTSQASEPEITARRNDAIAQDQVVAMTATGKELFDGL
FT                   RSELQELNSLTDERVTEQVDRVRSAQILANVATAVAFVLAVGTAIISGYLTRRLLTQPI
FT                   ERLVADISAVAEGDYERKIGTDGPREVSMIGGAVDTMRNSLLTQNRLLVQAEHERTRHD
FT                   EQTRMAADLHDLTIQRVFGLGLALTSVARRHPRLTADLDPLIDETDSIVRGLRAVIFDL
FT                   QMGSASLTNGTASLSAAVGEIVESSTAALGFTPDVCLDGPVDLFSGHDAGPELQAVLRE
FT                   ALSNVARHAHATSCRVMVAADDDRLTLSVTDDGTGIGEDAVRGHGLANICNRAAQLGGR
FT                   AVIRDGAPGTVVEWEVPAS"
     MTGRTANARR MSLRTLLWLA IGILVALFAV SAAFSVYGRL VVRASEDVLS ERLLPAQRAV        60
     SDLTTAYVDQ ETGQRGYVLT GDPRFLEPYD AGRSAAAASL SDLTALLGGD AEASATLDAV       120
     VEAANTWTSQ ASEPEITARR NDAIAQDQVV AMTATGKELF DGLRSELQEL NSLTDERVTE       180
     QVDRVRSAQI LANVATAVAF VLAVGTAIIS GYLTRRLLTQ PIERLVADIS AVAEGDYERK       240
     IGTDGPREVS MIGGAVDTMR NSLLTQNRLL VQAEHERTRH DEQTRMAADL HDLTIQRVFG       300
     LGLALTSVAR RHPRLTADLD PLIDETDSIV RGLRAVIFDL QMGSASLTNG TASLSAAVGE       360
     IVESSTAALG FTPDVCLDGP VDLFSGHDAG PELQAVLREA LSNVARHAHA TSCRVMVAAD       420
     DDRLTLSVTD DGTGIGEDAV RGHGLANICN RAAQLGGRAV IRDGAPGTVV EWEVPAS          477
//

If you have problems or comments...

PBIL Back to PBIL home page