(data stored in ACNUC7421 zone)

EMBL: AP011115.PE36

AP011115.PE36        Location/Qualifiers
FT   CDS             complement(30731..31504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48283"
FT                   /db_xref="GOA:C1AS34"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS34"
FT                   /protein_id="BAH48283.1"
FT                   /translation="MTLTVALALGAIIGVLLGLLGGGGSILAVPALVFGLGLGLEEAIP
FT                   ISLIVIGVASLVGAIPKIREHQVNWRMAGVFAACGIPATFAGSAVGRLLPQPVVMIGFA
FT                   AVMIVAGIRMLMDRGDTGTACEVGDSGIDWRRCAPRSIPAAALVGFLTGLFGVGGGFLI
FT                   IPALVLMLGLEMPVAIGTSLVIIVANSAAGLISHLSGASIDWAITAAFAGTAIAGSLIA
FT                   SHFGTRVDTDRLQRWFAYLVFVVAAYVLVDTILLR"
     MTLTVALALG AIIGVLLGLL GGGGSILAVP ALVFGLGLGL EEAIPISLIV IGVASLVGAI        60
     PKIREHQVNW RMAGVFAACG IPATFAGSAV GRLLPQPVVM IGFAAVMIVA GIRMLMDRGD       120
     TGTACEVGDS GIDWRRCAPR SIPAAALVGF LTGLFGVGGG FLIIPALVLM LGLEMPVAIG       180
     TSLVIIVANS AAGLISHLSG ASIDWAITAA FAGTAIAGSL IASHFGTRVD TDRLQRWFAY       240
     LVFVVAAYVL VDTILLR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page